FMO2 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of flavin containing monooxygenase 2 (non-functional) (FMO2)
USD 436.00
Recombinant protein of human flavin containing monooxygenase 2 (non-functional) (FMO2), 20 µg
USD 867.00
Other products for "FMO2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FMO2 antibody: synthetic peptide directed towards the N terminal of human FMO2. Synthetic peptide located within the following region: KYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVFDAVMVCSGHHI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 54 kDa |
Gene Name | flavin containing monooxygenase 2 |
Database Link | |
Background | The flavin-containing monooxygenases are NADPH-dependent enzymes that catalyze the oxidation of many drugs and xenobiotics. In most mammals, there is a flavin-containing monooxygenase that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, in humans, this enzyme is truncated and is probably rapidly degraded. The protein encoded by this gene represents the truncated form and apparently has no catalytic activity. A functional allele found in African Americans has been reported, but no sequence evidence has been deposited to support the finding. This gene is found in a cluster with the FMO1, FMO3, and FMO4 genes on chromosome 1. |
Synonyms | FMO1B1 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Mouse: 85% |
Reference Data | |
Protein Pathways | Drug metabolism - cytochrome P450 |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.