Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
USD 535.00
5 Days
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Rabbit polyclonal antibody to Collagen I alpha2 (collagen, type I, alpha 2)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1057 and 1366 of Collagen I alpha2 (Uniprot ID#P08123) |
Rabbit Polyclonal Anti-COL1A1 Antibody, Purified
| Applications | ELISA, IF, IHC, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Purified Collagen type I from Human skin. |
BP8028S is a replacement of BP8028.
Rabbit Polyclonal Anti-COL1A2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A2 antibody: synthetic peptide directed towards the middle region of human COL1A2. Synthetic peptide located within the following region: PGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPG |
Collagen I (COL1A1) mouse monoclonal antibody, clone NFI/20, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- COLLAGEN I