Antibodies

Jump to Filters
View as table Download
ANKFY1 Rabbit Polyclonal Antibody
TA331370

USD 539.00

5 Days

Rabbit Polyclonal Anti-ANKFY1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ANKFY1 antibody is: synthetic peptide directed towards the C-terminal region of Human ANKFY1. Synthetic peptide located within the following region: VNGTSFDENSFAARLIQRGSHTDAPDTATGKARASRRGDAGVCRRQEMAC
ANKFY1 Rabbit Polyclonal Antibody
TA358960

USD 539.00

5 Days

ANKFY1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ANKFY1 antibody is: synthetic peptide directed towards the N-terminal region of Human ANFY1