ANKFY1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of ankyrin repeat and FYVE domain containing 1 (ANKFY1), transcript variant 2
USD 665.00
Recombinant protein of human ankyrin repeat and FYVE domain containing 1 (ANKFY1), transcript variant 2, 20 µg
USD 867.00
Other products for "ANKFY1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ANKFY1 antibody is: synthetic peptide directed towards the C-terminal region of Human ANKFY1. Synthetic peptide located within the following region: VNGTSFDENSFAARLIQRGSHTDAPDTATGKARASRRGDAGVCRRQEMAC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 54 kDa |
Gene Name | ankyrin repeat and FYVE domain containing 1 |
Database Link | |
Background | This gene encodes a cytoplasmic protein that contains a coiled-coil structure and a BTB/POZ domain at its N-terminus, ankyrin repeats in the middle portion, and a FYVE-finger motif at its C-terminus. This protein belongs to a subgroup of double zinc finger proteins which may be involved in vesicle or protein transport. Alternate splicing results in multiple transcript variants of this gene. |
Synonyms | ANKHZN; DKFZp686M19106; KIAA1255; ZFYVE14 |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.