Antibodies

View as table Download

Rabbit Polyclonal Anti-SFTPB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SFTPB antibody: synthetic peptide directed towards the middle region of human SFTPB. Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV

SFTPB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 94-393 of human SFTPB (NP_000533.3).
Modifications Unmodified

SFTPB rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Porcine
Conjugation Unconjugated
Immunogen Human-based 60-amino acid synthetic SP-B polypeptide