SFTPB Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human surfactant protein B (SFTPB), transcript variant 2, 20 µg
USD 867.00
Transient overexpression lysate of surfactant protein B (SFTPB), transcript variant 2
USD 436.00
Other products for "SFTPB"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SFTPB antibody: synthetic peptide directed towards the middle region of human SFTPB. Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 42 kDa |
Gene Name | surfactant protein B |
Database Link | |
Background | SFTPB is the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins. See also SFTPA1, SFTPC, and SFTPD. The SFTPB gene encodes the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark et al., 1995 [PubMed 7644495]). See also SFTPA1 (MIM 178630), SFTPC (MIM 178620), and SFTPD (MIM 178635). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | PSP-B; SFTB3; SFTP3; SMDP1; SP-B |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Mouse: 92%; Bovine: 86%; Rabbit: 85%; Sheep: 79% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.