Antibodies

Jump to Filters
View as table Download
KIAA0319 Rabbit Polyclonal Antibody
TA341962

USD 485.00

5 Days

Rabbit Polyclonal Anti-KIAA0319 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA0319 antibody: synthetic peptide directed towards the N terminal of human KIAA0319. Synthetic peptide located within the following region: EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG
KIAA0319 Rabbit Polyclonal Antibody
TA377781

USD 365.00

3 Weeks

KIAA0319 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-300 of human KIAA0319 (NP_055624.2).
Modifications Unmodified