KIAA0319 Rabbit Polyclonal Antibody
Frequently bought together (2)
Recombinant protein of human KIAA0319 (KIAA0319), 20 µg
USD 867.00
Other products for "KIAA0319"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KIAA0319 antibody: synthetic peptide directed towards the N terminal of human KIAA0319. Synthetic peptide located within the following region: EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 56 kDa |
Gene Name | KIAA0319 |
Database Link | |
Background | This gene encodes a transmembrane protein that contains a large extracellular domain with multiple polycystic kidney disease (PKD) domains.The encoded protein may play a role inThe development ofThe cerebral cortex by regulating neuronal migration and cell adhesion. Single nucleotide polymorphisms inThis gene are associated with dyslexia. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Nov 2011] |
Synonyms | DYLX2; DYX2; NMIG |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 86%; Bovine: 86%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.