KIAA0319 Rabbit Polyclonal Antibody

CAT#: TA341962

Rabbit Polyclonal Anti-KIAA0319 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human KIAA0319 (KIAA0319), 20 µg
    • 20 ug

USD 867.00

Other products for "KIAA0319"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KIAA0319 antibody: synthetic peptide directed towards the N terminal of human KIAA0319. Synthetic peptide located within the following region: EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name KIAA0319
Background This gene encodes a transmembrane protein that contains a large extracellular domain with multiple polycystic kidney disease (PKD) domains.The encoded protein may play a role inThe development ofThe cerebral cortex by regulating neuronal migration and cell adhesion. Single nucleotide polymorphisms inThis gene are associated with dyslexia. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Nov 2011]
Synonyms DYLX2; DYX2; NMIG
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 86%; Bovine: 86%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.