Antibodies

View as table Download

Rabbit Polyclonal TdT Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

TdT (DNTT) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human TDT

Rabbit Polyclonal Anti-DNTT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNTT antibody: synthetic peptide directed towards the N terminal of human DNTT. Synthetic peptide located within the following region: FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG

Rabbit Polyclonal Anti-DNTT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNTT antibody: synthetic peptide directed towards the middle region of human DNTT. Synthetic peptide located within the following region: LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN

TdT (DNTT) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 445-475 amino acids from the C-terminal region of human TdT