Antibodies

View as table Download

Rabbit Polyclonal Anti-PKLR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Anti-PKLR mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated