Rabbit Polyclonal Anti-SFTPB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFTPB antibody: synthetic peptide directed towards the middle region of human SFTPB. Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV |
SFTPB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 94-393 of human SFTPB (NP_000533.3). |
| Modifications | Unmodified |
SFTPB rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Pig SP-B from pig lungs which has been reconstituted in micelles of lysophosphatidylcholine |
SFTPB rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Human-based 60-amino acid synthetic SP-B polypeptide |
Rabbit monoclonal to SP-B (Surfactant protein B)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China