Antibodies

Jump to Filters
View as table Download
CERK Rabbit Polyclonal Antibody
TA349654

USD 380.00

In Stock

Rabbit Polyclonal Anti-CERK Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CERK
CERK Rabbit Polyclonal Antibody
TA301540

USD 550.00

5 Days

Rabbit Polyclonal Antibody against Ceramide Kinase

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human ceramide kinase protein sequence (between residues 50-150). [Swiss-Prot Q8TCT0]
CERK Rabbit Polyclonal Antibody
TA337994

USD 539.00

5 Days

Rabbit Polyclonal Anti-CERK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CERK antibody is: synthetic peptide directed towards the C-terminal region of Human CERK. Synthetic peptide located within the following region: FVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSS