Rabbit Polyclonal antibody to PGAM1 (phosphoglycerate mutase 1 (brain))
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Monkey, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 16 and 199 of PGAM1 (Uniprot ID#P18669) |
Rabbit polyclonal antibody to PGAM1 (phosphoglycerate mutase 1 (brain))
| Applications | WB |
| Reactivities | Human (Predicted: Rat, Xenopus, Chicken, Chimpanzee, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 191 and 254 of PGAM1 (Uniprot ID#P18669) |
Goat Polyclonal Antibody against PGAM1 / PGAM2 / PGAM4
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KAMEAVAAQGKAKK, from the C Terminus of the protein sequence according to NP_002620.1; NP_000281.2; NP_001025062.1. |
Rabbit Polyclonal Anti-PGAM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGAM1 antibody is: synthetic peptide directed towards the C-terminal region of Human PGAM1. Synthetic peptide located within the following region: EEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGK |
Germany
Japan
United Kingdom
China
