PGAM1 Rabbit Polyclonal Antibody

CAT#: TA343179

Rabbit Polyclonal Anti-PGAM1 Antibody

Product Images

Host: Rabbit; Target Name: PGAM1; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGAM1 antibody is: synthetic peptide directed towards the C-terminal region of Human PGAM1. Synthetic peptide located within the following region: EEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: phosphoglycerate mutase 1
• Database Link:
  NP_002620
  Entrez Gene 5223 Human
  UniProt ID P18669
• Background: Phosphoglyceric acid mutase (EC 2.7.5.3) is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway.
• Synonyms: HEL-S-35; PGAM-B; PGAMA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways