Rabbit Polyclonal Anti-WNT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT2 |
Rabbit Polyclonal Anti-WNT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT2 |
Anti-AMH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 539-551 amino acids of human anti-Mullerian hormone |
Anti-GREM1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 25-184 amino acids of human gremlin 1 |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Anti-SERPINB5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-TNFRSF11B Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 195-365 amino acids of human tumor necrosis factor receptor superfamily, member 11b |
Rabbit Polyclonal IL-17 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | IL-17 antibody was raised against a 19 amino acid synthetic peptide from near the center of human IL-17A. The immunogen is located within amino acids 50 - 100 of IL-17. |
Anti-KLK7 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 30-253 amino acids of human kallikrein-related peptidase 7kallikrein-related peptidase 7 |
Anti-SYT7 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 54-200 amino acids of human synaptotagmin VII |
Rabbit Polyclonal anti-GNAS antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Rabbit monoclonal anti-POSTN antibody for SISCAPA, clone OTIR1A5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-MIME antibody for SISCAPA, clone OTIR4H1
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against LOX
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Porcine, Cow |
Conjugation | Unconjugated |
Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal NPTX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NPTX2 antibody was raised against a 16 amino acid synthetic peptide near the center of the human NPTX2. The immunogen is located within amino acids 170 - 220 of NPTX2. |