Antibodies

Jump to Filters
View as table Download
SFTPB Rabbit Polyclonal Antibody
TA346044

USD 539.00

5 Days

Rabbit Polyclonal Anti-SFTPB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SFTPB antibody: synthetic peptide directed towards the middle region of human SFTPB. Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV
SFTPB (Center) Rabbit Polyclonal Antibody
AP53885PU-N

USD 580.00

2 Weeks

SFTPB (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 128-158 amino acids from the Central region of Human SFTPB