Rabbit Polyclonal antibody to Ribosome binding protein 1 (ribosome binding protein 1 homolog 180kDa (dog))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1183 and 1410 of Ribosome binding protein 1 (Uniprot ID#Q9P2E9) |
Rabbit Polyclonal Anti-RRBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RRBP1 Antibody: synthetic peptide directed towards the N terminal of human RRBP1. Synthetic peptide located within the following region: TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF |
RRBP1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RRBP1 |
Germany
Japan
United Kingdom
China
