RRBP1 Rabbit Polyclonal Antibody

CAT#: TA335952

Rabbit Polyclonal Anti-RRBP1 Antibody

Product Images

WB Suggested Anti-RRBP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate;RRBP1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RRBP1 Antibody: synthetic peptide directed towards the N terminal of human RRBP1. Synthetic peptide located within the following region: TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 109 kDa
• Gene Name: ribosome binding protein 1
• Database Link:
  NP_001036041
  Entrez Gene 6238 Human
  UniProt ID Q9P2E9
• Background: Analysis of cDNA clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of RRBP1. The form presented here is lacking the canine p180 ribosome-binding domain, NQGKKAEGAQ, which is tandemly repeated close to the N-terminus in other forms that haven't been fully characterized. RRBP1 has been excluded as a candidate gene in the cause of Alagille syndrome.Analysis of cDNA clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of RRBP1. The form presented here is lacking the canine p180 ribosome-binding domain, NQGKKAEGAQ, which is tandemly repeated close to the N-terminus in other forms that haven't been fully characterized. RRBP1 has been excluded as a candidate gene in the cause of Alagille syndrome. Alternate splicing results in multiple transcript variants.
• Synonyms: 130; ES; ES130; hES; RRp
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 92%; Rat: 82%; Bovine: 82%; Dog: 81%; Rabbit: 81%; Pig: 76%; Guinea pig: 76%; Mouse: 75%

Reference Data

• Protein Families: Druggable Genome, Transmembrane