Antibodies

View as table Download

Fyn Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Fyn
Modifications Unmodified

Rabbit polyclonal Fyn (Phospho-Tyr530) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P).
Modifications Phospho-specific

Rabbit polyclonal Fyn (Ab-530) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P).

Rabbit Polyclonal Fyn (Tyr530) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Fyn around the phosphorylation site of Tyrosine 530
Modifications Phospho-specific

Phospho-SRC Family-Y416 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y416 of human SRC Family
Modifications Phospho Y416

FYN Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Fyn (phospho-Y530) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human Fyn around the phosphorylation site of Tyrosine 530.

Goat Polyclonal Antibody against FYN

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence VQCKDKEATKLTE, from the N Terminus of the protein sequence according to NP_002028.1; NP_694592.1; NP_694593.1.

Rabbit Polyclonal Fyn Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Fyn

Rabbit Polyclonal Anti-KYNU Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FYN

Rabbit polyclonal Anti-FYN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FYN antibody: synthetic peptide directed towards the middle region of human FYN. Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN

FYN rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FYN

FYN Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTATEPQYQPGENL

Fyn (phospho-Y530) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human Fyn around the phosphorylation site of Tyrosine 530.