Antibodies

Jump to Filters
View as table Download
SRMS (N-term) Rabbit Polyclonal Antibody
AP14477PU-N

USD 580.00

2 Weeks

SRMS (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human SRMS.
SRMS (C-term) Rabbit Polyclonal Antibody
AP14478PU-N

USD 580.00

2 Weeks

SRMS (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human SRMS.
SRMS Rabbit Polyclonal Antibody
TA343305

USD 539.00

5 Days

Rabbit Polyclonal Anti-SRMS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRMS antibody is: synthetic peptide directed towards the C-terminal region of SRMS. Synthetic peptide located within the following region: QQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRC
SRMS Rabbit Polyclonal Antibody
TA358419

USD 539.00

5 Days

SRMS Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated