SRMS Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "SRMS"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SRMS antibody is: synthetic peptide directed towards the C-terminal region of SRMS. Synthetic peptide located within the following region: QQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 54 kDa |
Gene Name | src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites |
Database Link | |
Background | SRMS may be involved in proliferation or differentiation of keratinocytes in the skin. |
Synonyms | C20orf148; dJ697K14.1; PTK70; SRM |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 82%; Pig: 82%; Horse: 82%; Bovine: 82%; Rat: 79%; Zebrafish: 75% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.