Antibodies

View as table Download

Rabbit Polyclonal PGAM1 Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human PGAM1 protein (between residues 200-254) [UniProt P18669]

PGAM1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-254 of human PGAM1 (NP_002620.1).
Modifications Unmodified

Rabbit Polyclonal antibody to PGAM1 (phosphoglycerate mutase 1 (brain))

Applications WB
Reactivities Human, Mouse (Predicted: Chicken, Monkey, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 16 and 199 of PGAM1 (Uniprot ID#P18669)

Rabbit polyclonal antibody to PGAM1 (phosphoglycerate mutase 1 (brain))

Applications WB
Reactivities Human (Predicted: Rat, Xenopus, Chicken, Chimpanzee, Bovine, Rhesus Monkey, X. tropicalis, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 191 and 254 of PGAM1 (Uniprot ID#P18669)

Goat Polyclonal Antibody against PGAM1 / PGAM2 / PGAM4

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-KAMEAVAAQGKAKK, from the C Terminus of the protein sequence according to NP_002620.1; NP_000281.2; NP_001025062.1.

Rabbit Polyclonal Anti-PGAM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGAM1 antibody is: synthetic peptide directed towards the C-terminal region of Human PGAM1. Synthetic peptide located within the following region: EEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGK

PGAM1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

PGAM1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PGAM1