Antibodies

View as table Download

Rat Polyclonal CaMKII beta Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was developed against a synthetic peptide corresponding to amino acids 499-513 (VRRGSGTPEAEAPRQ) of human CAMKII beta.

CaMKII Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human CaMKII

Anti-CAMK2B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 14-272 amino acids of human Calcium/calmodulin-dependent protein kinase type II subunit beta

Anti-CAMK2B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 14-272 amino acids of Human Calcium/calmodulin-dependent protein kinase type II subunit beta

CAMK2B rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal CaMK2- beta/ gamma/ delta (Thr287) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CaMK2- beta/ gamma/ delta around the phosphorylation site of Threonine 287
Modifications Phospho-specific

CaMKII beta Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human CaMKII

Rabbit Polyclonal CaMK2-beta/gamma/delta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CaMK2-beta/gamma/delta

CAMK2B (beta/gamma) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 601-652of Human CaMKIIβ.

Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E).
Modifications Phospho-specific

Rabbit Polyclonal Anti-Camk2b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Camk2b Antibody is: synthetic peptide directed towards the middle region of Rat Camk2b. Synthetic peptide located within the following region: DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG

CaMKII Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human CaMKII (NP_742078.1).
Modifications Unmodified

CaMK2 delta/CAMK2 gamma Rabbit mAb

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMK2 delta/CAMK2 gamma (Q13554).