Antibodies

View as table Download

Rabbit Polyclonal Anti-CD81 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE

TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE

Applications FC
Reactivities Feline, Human, Rabbit
Conjugation PE

TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified

Applications FC, FN, IF, IHC, IP, WB
Reactivities Feline, Human, Rabbit
Conjugation Unconjugated

Rabbit Polyclonal CD81 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CD81 antibody was raised against a 20 amino acid peptide near the amino terminus of human CD81.