CD19 mouse monoclonal antibody, clone OTI3B10
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD19 mouse monoclonal antibody, clone OTI3B10
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD19 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD19 mouse monoclonal antibody, clone UMAB103
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD19 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD22 mouse monoclonal antibody, clone OTI4C3 (formerly 4C3)
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
CD19 mouse monoclonal antibody, clone OTI3B10
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD19 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
Applications | FC, FN, IF, IHC, IP, WB |
Reactivities | Feline, Human, Rabbit |
Conjugation | Unconjugated |
CD19 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal CD81 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CD81 antibody was raised against a 20 amino acid peptide near the amino terminus of human CD81. |
Anti-LILRB3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 560-572 amino acids of human leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 |
CD19 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, Purified
Applications | FC, IHC, IP |
Reactivities | Porcine |
Conjugation | Unconjugated |
Mouse Monoclonal CD21 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |