NPAS2 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human NPAS2. |
NPAS2 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human NPAS2. |
Rabbit Polyclonal Anti-NPAS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NPAS2 Antibody: synthetic peptide directed towards the N terminal of human NPAS2. Synthetic peptide located within the following region: MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLE |
Rabbit Polyclonal Anti-NPAS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NPAS2 Antibody: synthetic peptide directed towards the C terminal of human NPAS2. Synthetic peptide located within the following region: DSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR |
Rabbit Polyclonal Anti-Npas2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Npas2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PLQPAQAQQQPPPYLQAPTSLHSEQPDSLLLSTFSQQPGTLGYAATQSTP |
Rabbit Polyclonal Anti-Npas2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Npas2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VSYADVRVERRQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGAS |
Npas2 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human Npas2 |