Npas2 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "Npas2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Npas2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VSYADVRVERRQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGAS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 91 kDa |
Gene Name | neuronal PAS domain protein 2 |
Database Link | |
Background | BMAL1-NPAS2 heterodimers activate E-box element (3'-CACGTG-5') transcription of a number of proteins ofThe circadian clock.This transcription is inhibited in a feedback loop by PER, and also by CRY proteins. |
Synonyms | bHLHe9; FLJ23138; MGC71151; MOP4; PASD4 |
Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Bovine: 85%; Pig: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.