Antibodies

View as table Download

GBAS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GBAS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

GBAS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

GBAS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GBAS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GBAS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

GBAS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

NIPSNAP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NIPSNAP2

GBAS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

GBAS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal NIPSNAP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NIPSNAP2 antibody was raised against a 14 amino acid peptide near the amino terminus of human NIPSNAP2.

Rabbit Polyclonal NIPSNAP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NIPSNAP2 antibody was raised against a 14 amino acid peptide near the center of human NIPSNAP2.

Rabbit Polyclonal Anti-GBAS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GBAS antibody: synthetic peptide directed towards the middle region of human GBAS. Synthetic peptide located within the following region: VPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIG

NIPSNAP2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GBAS

NIPSNAP2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NIPSNAP2