GBAS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
GBAS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBAS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
GBAS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBAS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBAS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GBAS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBAS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
NIPSNAP2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NIPSNAP2 |
GBAS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GBAS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal NIPSNAP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NIPSNAP2 antibody was raised against a 14 amino acid peptide near the amino terminus of human NIPSNAP2. |
Rabbit Polyclonal NIPSNAP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NIPSNAP2 antibody was raised against a 14 amino acid peptide near the center of human NIPSNAP2. |
Rabbit Polyclonal Anti-GBAS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GBAS antibody: synthetic peptide directed towards the middle region of human GBAS. Synthetic peptide located within the following region: VPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIG |
NIPSNAP2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GBAS |
NIPSNAP2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NIPSNAP2 |