Transferrin (TF) sheep polyclonal antibody, Purified
| Applications | ID |
| Reactivities | Feline, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human holo-Transferrin. Antisera to Human Transferrin were raised by repeated immunisation of Sheep with highly purified antigen. |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
| Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
| Conjugation | Unconjugated |
Histidine decarboxylase (HDC) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Histidine Decarboxylase produced in E.coli. |
Synaptopodin (SYNPO) mouse monoclonal antibody, clone G1D4, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Calca goat polyclonal antibody, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Mouse, Reptiles, Rat, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic Rat Tyr-CGRP (23-37) conjugated to gamma Globulin |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila, Fish, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus, Beluga, Hamster, Guinea Pig, C. elegans |
| Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
USD 500.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
| Applications | FC, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Equine, Guinea Pig, Hamster, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Peptide from the C Terminus of the protein sequence according to NP_000691.1 |
TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3. |
Mouse monoclonal Hsp60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Monkey, Pig, Rabbit, Helicobacter pylori, Hamster, Spinach, Salmonella Typhimurium, Trichinella spiralis, Yeast, Escherichia coli, White Fly |
| Conjugation | Unconjugated |
TAC1 mouse monoclonal antibody, clone SP-DE4-21, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Guinea Pig, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
