Rabbit polyclonal Anti-Sema3f Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH |
Anti-SEMA3G Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3G |
Rabbit polyclonal anti-Neuropilin-1 antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 816 of mouse Neuropilin 1 |
Rabbit anti-NRP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NRP1 |
Rabbit anti Neuropilin-1 (pT916) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope –LNTQS- with a phosphorylation site at Thr916. This sequence is identical among human and bovine. |
Rabbit anti Neuropilin-1 (Paired T916) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope –LNTQS- without phosphorylation site at Thr916. This sequence is identical among human and bovine. |
Rabbit Polyclonal Anti-SDF 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Germany
Japan
United Kingdom
China
