Rabbit Polyclonal Anti-AURKC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AURKC |
Rabbit Polyclonal Anti-AURKC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AURKC |
Rabbit polyclonal Aurora-C Antibody (N-term G11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C. |
Rabbit polyclonal AurB/C (Ab-202/175) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AurB/C around the phosphorylation site of threonine 202/175 (C-G-TP-L-D). |
Goat Anti-AURKC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PRAVVQLGKAQP-C, from the N Terminus of the protein sequence according to NP_001015878.1. |
Rabbit polyclonal Aurora-C Antibody (N-term M1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C. |
Rabbit Polyclonal Anti-AURKC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AURKC Antibody: synthetic peptide directed towards the middle region of human AURKC. Synthetic peptide located within the following region: TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL |