Antibodies

View as table Download

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal DUOX2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8]

Rabbit Polyclonal Niemann-Pick C1 Antibody

Applications Electron Microscopy, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Porcine, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118]

Mu Opioid Receptor (OPRM1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 161-187 amino acids from the Center region of human OPRM1

TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3.

XPR1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Bovine, Bat, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from the N-terminal cytoplasmic domain of human XPR1.

Rabbit Polyclonal Aquaporin-2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminus portion of the rat protein (within residues 200-300). [Swiss-Prot# P34080]

WNT3 (315-329) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human WNT3

Rabbit Polyclonal Lgr5/GPR49 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Porcine, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human GPR49/LGR5 protein (within residues 650-700). [Swiss-Prot# O75473]

Rabbit Polyclonal SLC31A1/CTR1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Porcine, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen A synthetic peptide derived from a C-terminal sequence of the human CTR1.

beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase

Aminopeptidase A (ENPEP) (689-032) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 689 and 932 of Human ENPEP

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Porcine, Monkey, Rabbit, Sheep, Xenopus, Hamster, Guinea Pig
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Activin Receptor Type IA (ACVR1) (147-161) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Canine, Human, Mouse, Rat, Bovine, Bat, Equine, Monkey, Porcine, Rabbit
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human ACVR1

Calnexin (CANX) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Canine, Bovine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus
Conjugation Unconjugated
Immunogen CANX antibody was raised against synthetic peptide derived from sequence near the amino-terminus of canine Calnexin, conjugated to KLH