Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
Applications | FC, ICC/IF, IHC, IP, WB |
Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
Conjugation | Unconjugated |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
Applications | FC, ICC/IF, IHC, IP, WB |
Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal DUOX2 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Canine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8] |
Rabbit Polyclonal Niemann-Pick C1 Antibody
Applications | Electron Microscopy, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Mu Opioid Receptor (OPRM1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 161-187 amino acids from the Center region of human OPRM1 |
TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3. |
Mouse Monoclonal Bestrophin 1 Antibody (E6-6)
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Porcine, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Aquaporin-2 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminus portion of the rat protein (within residues 200-300). [Swiss-Prot# P34080] |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human WNT3 |
Rabbit Polyclonal Lgr5/GPR49 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Porcine, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human GPR49/LGR5 protein (within residues 650-700). [Swiss-Prot# O75473] |
USD 550.00
In Stock
Mouse Monoclonal Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))
Applications | ICC/IF, IHC, WB |
Reactivities | Bovine, Canine, Human, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal SLC31A1/CTR1 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Porcine, Rat, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from a C-terminal sequence of the human CTR1. |
beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase |
Aminopeptidase A (ENPEP) (689-032) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 689 and 932 of Human ENPEP |
CD62E (SELE) (+CD62P) mouse monoclonal antibody, clone 1.2B6, Purified
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |