Antibodies

View as table Download

Rabbit Polyclonal Anti-AURKC Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AURKC

Rabbit polyclonal Aurora-C Antibody (N-term G11)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C.

Rabbit polyclonal AurB/C (Ab-202/175) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AurB/C around the phosphorylation site of threonine 202/175 (C-G-TP-L-D).

Rabbit polyclonal Aurora-C Antibody (N-term M1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C.

Rabbit Polyclonal Anti-AURKC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AURKC Antibody: synthetic peptide directed towards the middle region of human AURKC. Synthetic peptide located within the following region: TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL