Mouse Monoclonal Osteopontin Antibody (1B20)
Applications | ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Rabbit, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal Osteopontin Antibody (1B20)
Applications | ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal LOX Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Bovine, Primate |
Conjugation | Unconjugated |
Immunogen | Within the range of amino acids 305-338 of human LOX protein were used as the immunogen. |
Mouse Monoclonal Tenascin C Antibody (4C8MS)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584] |
Mouse Monoclonal VEGF Antibody (VG1)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Canine |
Conjugation | Unconjugated |
Rabbit Polyclonal Calreticulin Antibody
Applications | Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A fusion protein to mouse Calreticulin [UniProt# P14211] |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal SEMA3B Antibody
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200). |
Rabbit Polyclonal Antibody against LOX
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Porcine, Cow |
Conjugation | Unconjugated |
Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
DCN Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DCN |
Rabbit Polyclonal LOX propeptide Antibody
Applications | ICC/IF, IHC, Immunoblotting, WB |
Reactivities | Human, Mouse, Rat, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301] |
Mouse Monoclonal TEM7/PLXDC1 Antibody (197C193 (IM193))
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal TNF-alpha Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Rabbit Polyclonal F12 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human F12 protein (between residues 50-150) [UniProt P00748] |
Rabbit Polyclonal EPO Receptor Antibody
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human EPO receptor protein (between residues 300-400) [UniProt P19235] |