Antibodies

View as table Download

Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437.

Rabbit Polyclonal Ki-67/MKI67 Antibody

Applications FC, ICC/IF, IHC, Immunoblotting, IP, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013]
TA336650 is a possible alternative to TA336566.

Rabbit Polyclonal Aggrecan Neoepitope Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112]

Rabbit Polyclonal Antibody against ATG5

Applications Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0]

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]

Rabbit Polyclonal beta-Actin Antibody

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].

Rabbit Polyclonal Perilipin Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat, Sheep
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240]

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal DUOX2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8]

Rabbit Polyclonal Beclin 1/ATG6 Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457]

Rabbit Polyclonal Antibody against LOX

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Cow
Conjugation Unconjugated
Immunogen A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300

Rabbit Polyclonal SCP3 Antibody

Applications ICC/IF, IHC, Immunoblotting, IP, WB
Reactivities Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of the human SCP3 protein.

Rabbit Polyclonal Niemann-Pick C1 Antibody

Applications Electron Microscopy, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Porcine, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118]

Rabbit Polyclonal Pyruvate Carboxylase Antibody

Applications ICC/IF, IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498]

Rabbit Polyclonal LOX propeptide Antibody

Applications ICC/IF, IHC, Immunoblotting, WB
Reactivities Human, Mouse, Rat, Porcine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301]