Langerin (CD207) rat monoclonal antibody, clone 929F3.01
Applications | FC, IF, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Alexa Fluor 488 |
Langerin (CD207) rat monoclonal antibody, clone 929F3.01
Applications | FC, IF, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Alexa Fluor 488 |
Rabbit Polyclonal beta-Actin Antibody
Applications | Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Porcine, Avian, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709]. |
USD 525.00
2 Weeks
Mannose Receptor (MRC1) (Extracell. Dom.) mouse monoclonal antibody, clone 122D2.08
Applications | FC, FN, IHC, IP, Neutralize, WB |
Reactivities | Human, Porcine, Sheep |
Conjugation | Unconjugated |
Cytokeratin 18 (KRT18) mouse monoclonal antibody, clone RGE53, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Canine, Chicken, Hamster, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Integrin beta 1 (ITGB1) mouse monoclonal antibody, clone MEM-101A, FITC
Applications | FC |
Reactivities | Canine, Human, Porcine |
Conjugation | FITC |
Rabbit Polyclonal Perilipin Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Mouse Monoclonal Blimp-1 Antibody (3H2-E8)
Applications | ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Porcine |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Cytokeratin 20 (KRT20) mouse monoclonal antibody, clone KS20.10, FITC
Applications | FC, IF, IHC |
Reactivities | Human, Porcine, Rat |
Conjugation | FITC |
Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, WB |
Reactivities | Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep |
Conjugation | Unconjugated |
Langerin (CD207) rat monoclonal antibody, clone 929F3.01
Applications | FC, IF, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Alexa Fluor 647 |
CD283 / TLR3 mouse monoclonal antibody, clone 722E2.01
Applications | FC, IHC, WB |
Reactivities | Canine, Human, Mouse, Porcine, Rat, Sheep |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against CUG-BP1 (3B1)
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
CD14 mouse monoclonal antibody, clone Tük4, PE
Applications | FC |
Reactivities | Bovine, Canine, Goat, Human, Porcine, Rabbit, Sheep |
Conjugation | PE |
Mu Opioid Receptor (OPRM1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 161-187 amino acids from the Center region of human OPRM1 |