Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
USD 500.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
Applications | FC, IHC, WB |
Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Neurokinin 1 Receptor Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Guinea Pig, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the N-terminus of human NK-1 sequence conjugated to KLH. |
CD79A (208-222) mouse monoclonal antibody, clone HM47, Purified
Applications | FC, IHC, IP, WB |
Reactivities | Bovine, Canine, Chicken, Equine, Guinea Pig, Human, Mouse, Porcine, Primate, Rabbit, Rat |
Conjugation | Unconjugated |
USD 570.00
2 Weeks
alpha smooth muscle Actin (ACTA2) mouse monoclonal antibody, clone SPM332, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Baboon, Bovine, Canine, Chicken, Feline, Guinea Pig, Goat, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep |
Conjugation | Unconjugated |
USD 315.00
2 Weeks
Cytokeratin 4+5+6+8+10+13+18 mouse monoclonal antibody, clone SPM583, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Bovine, Frog, Guinea Pig, Goat, Human, Marmoset, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Cytokeratin (basal cell) mouse monoclonal antibody, clone RCK103, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Canine, Chicken, Guinea Pig, Hamster, Human, Porcine, Quail, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Thy1 mouse monoclonal antibody, clone OX-7, FITC
Applications | FC |
Reactivities | Guinea Pig, Mouse, Rabbit, Rat |
Conjugation | FITC |
Thy1 mouse monoclonal antibody, clone OX-7, FITC
Applications | FC |
Reactivities | Guinea Pig, Mouse, Rabbit, Rat |
Conjugation | FITC |
Thy1 mouse monoclonal antibody, clone OX-7, FITC
Applications | FC |
Reactivities | Guinea Pig, Mouse, Rabbit, Rat |
Conjugation | FITC |
CD79A (202-216) mouse monoclonal antibody, clone HM57, Purified
Applications | FC, IHC, WB |
Reactivities | Bison, Bovine, Canine, Chicken, Deer, Equine, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
USD 315.00
2 Weeks
alpha smooth muscle Actin (ACTA2) mouse monoclonal antibody, clone SPM332, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Baboon, Bovine, Canine, Chicken, Feline, Guinea Pig, Goat, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep |
Conjugation | Unconjugated |
Thy1 mouse monoclonal antibody, clone OX-7, Purified
Applications | FC, IHC, IP, WB |
Reactivities | Guinea Pig, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Thy1 mouse monoclonal antibody, clone OX-7, Purified
Applications | FC, IHC, IP, WB |
Reactivities | Guinea Pig, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |