Antibodies

Jump to Filters
View as table Download
hnRNP A2B1 (HNRNPA2B1) Rabbit Polyclonal Antibody
TA326961

USD 450.00

2 Weeks

HNRNPA2B1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HNRNPA2B1
hnRNP A2B1 (HNRNPA2B1) Rabbit Polyclonal Antibody
TA343942

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-HNRNPA2B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPA2B1 antibody: synthetic peptide directed towards the N terminal of human HNRNPA2B1. Synthetic peptide located within the following region: MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC
hnRNP A2B1 (HNRNPA2B1) Rabbit Polyclonal Antibody
TA314019

USD 380.00

4 Weeks

Rabbit polyclonal hnRNP A2/B1 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human hnRNP A2/B1.