Antibodies

View as table Download

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal Anti-MUC1(NT) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1(NT)

Rabbit Polyclonal Anti-MUC1(CT) Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MUC1(CT)

Rabbit polyclonal CD227/MUC1 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CD227/MUC1.

EMA (MUC1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal CD227/MUC1 (Tyr1229) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CD227/MUC1 around the phosphorylation site of tyrosine 1229 (S-P-YP-E-K)
Modifications Phospho-specific

EMA (MUC1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to human CD227 / Mucin-1 / MUC1 (between 1202-1231aa)

Rabbit polyclonal anti-PGRMC2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human PGRMC2.

Rabbit Polyclonal Anti-Phospho-CD227/MUC1(Tyr1229) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-CD227/MUC1(Tyr1229) Antibody: A synthesized peptide derived from human CD227/MUC1 around the phosphorylation site of Tyrosine 1229
Modifications Phospho-specific