Rabbit Polyclonal LOX Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Bovine, Primate |
Conjugation | Unconjugated |
Immunogen | Within the range of amino acids 305-338 of human LOX protein were used as the immunogen. |
Rabbit Polyclonal LOX Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Bovine, Primate |
Conjugation | Unconjugated |
Immunogen | Within the range of amino acids 305-338 of human LOX protein were used as the immunogen. |
Rabbit Polyclonal Calreticulin Antibody
Applications | Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A fusion protein to mouse Calreticulin [UniProt# P14211] |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit Polyclonal SEMA3B Antibody
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200). |
Rabbit polyclonal antibody to Amphiphysin (amphiphysin)
Applications | IHC, WB |
Reactivities | Human (Predicted: Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 194 of Amphiphysin (Uniprot ID#P49418) |
SFTPC (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, WB |
Reactivities | Bovine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SFTPC. |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Dog, Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2) |
Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Feline, Pig, Chicken, Sheep, Bovine) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse, Orang-Utan (Predicted: Bat, Bovine, Xenopus) |
Conjugation | Unconjugated |
Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, R, WB |
Reactivities | Bovine, Deer, Goat, Human, Sheep |
Conjugation | Unconjugated |
Immunogen | Bovine Luteinizing Hormone |
Rabbit polyclonal IGFBP2 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Bovine, Pig) |
Conjugation | Unconjugated |
Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Rabbit Polyclonal AG-2 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Bovine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an N-terminal portion of mouse AGR2 (within residues 1-50). [Swiss-Prot# O88312] |
Rabbit Polyclonal antibody to alpha 2 Antiplasmin (serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rabbit, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 188 and 453 of alpha 2 Antiplasmin (Uniprot ID#P08697) |
Rabbit Polyclonal antibody to AGR3 (anterior gradient homolog 3 (Xenopus laevis))
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 166 of AGR3 (Uniprot ID#Q8TD06) |