Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3. |
Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Pig, Bovine, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559) |
USD 515.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Gibbon, Orang-Utan (Predicted: Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Porcine, Monkey, Rabbit, Sheep, Xenopus, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Calnexin (CANX) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Canine, Bovine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | CANX antibody was raised against synthetic peptide derived from sequence near the amino-terminus of canine Calnexin, conjugated to KLH |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
CCKAR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Gibbon (Predicted: Monkey, Bovine, Rabbit, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CCKAR / CCK1R antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CCKAR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Rabbit, Guinea pig (94%); Mouse, Elephant, Panda, Bat (88%); Rat, Dog, Horse, Opossum (81%). |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Rabbit, Pig, Canine, Chicken, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rat, Rabbit, Guinea Pig, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 293 and 387 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1) |
Germany
Japan
United Kingdom
China
