Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ATF3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF3. |
Rabbit Polyclonal Anti-ATF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF3 antibody: synthetic peptide directed towards the middle region of human ATF3. Synthetic peptide located within the following region: PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK |
ATF3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 139-168 amino acids from the C-terminal region of human ATF3 |
Rabbit Polyclonal anti-Atf3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Atf3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Atf3. Synthetic peptide located within the following region: ESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFI |
Rabbit anti-ATF3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF3 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- ATF3
Antibody Hosts
- Rabbit