Antibodies

Jump to Filters
View as table Download
PTPN7 Rabbit Polyclonal Antibody
TA350309

USD 380.00

In Stock

Rabbit Polyclonal Anti-PTPN7 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PTPN7
PTPN7 Rabbit Polyclonal Antibody
TA369291

USD 380.00

4 Weeks

PTPN7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PTPN7
PTPN7 Rabbit Polyclonal Antibody
TA343182

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTPN7 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ptpn7 antibody is: synthetic peptide directed towards the middle region of Rat Ptpn7. Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ