PTPN7 Rabbit Polyclonal Antibody

CAT#: TA343182

Rabbit Polyclonal Anti-PTPN7 Antibody

Product Images

Host: Rabbit; Target Name: Ptpn7; Sample Tissue: Rat Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ptpn7 antibody is: synthetic peptide directed towards the middle region of Rat Ptpn7. Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: protein tyrosine phosphatase, non-receptor type 7
• Database Link:
  NP_002823
  Entrez Gene 246781 Rat
  UniProt ID P35236
• Background: Tyrosine phosphatase found in T cells, B cells and mast cells.
• Synonyms: BPTP-4; HEPTP; LC-PTP; LPTP; PTPNI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Horse: 92%; Zebrafish

Reference Data

• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: MAPK signaling pathway