Antibodies

View as table Download

Rabbit Polyclonal PLAC3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PLAC3 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human PLAC3.

PAPP A2 (PAPPA2) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal Anti-PAPPA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAPPA2 antibody: synthetic peptide directed towards the N terminal of human PAPPA2. Synthetic peptide located within the following region: PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL

Rabbit Polyclonal Anti-PAPPA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAPPA2 antibody: synthetic peptide directed towards the middle region of human PAPPA2. Synthetic peptide located within the following region: ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL