Rabbit Polyclonal PLAC3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PLAC3 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human PLAC3. |
Rabbit Polyclonal PLAC3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PLAC3 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human PLAC3. |
PAPP A2 (PAPPA2) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal Anti-PAPPA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAPPA2 antibody: synthetic peptide directed towards the N terminal of human PAPPA2. Synthetic peptide located within the following region: PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL |
Rabbit Polyclonal Anti-PAPPA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAPPA2 antibody: synthetic peptide directed towards the middle region of human PAPPA2. Synthetic peptide located within the following region: ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL |