Antibodies

Jump to Filters
View as table Download
PAPP A2 (PAPPA2) Rabbit Polyclonal Antibody
TA319996

USD 570.00

5 Days

Rabbit Polyclonal PLAC3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PLAC3 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human PLAC3.
PAPP A2 (PAPPA2) (N-term) Rabbit Polyclonal Antibody
AP31246PU-N

USD 500.00

2 Weeks

PAPP A2 (PAPPA2) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated
PAPP A2 (PAPPA2) Rabbit Polyclonal Antibody
TA344168

USD 539.00

5 Days

Rabbit Polyclonal Anti-PAPPA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAPPA2 antibody: synthetic peptide directed towards the N terminal of human PAPPA2. Synthetic peptide located within the following region: PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL
PAPP A2 (PAPPA2) Rabbit Polyclonal Antibody
TA344169

USD 539.00

5 Days

Rabbit Polyclonal Anti-PAPPA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAPPA2 antibody: synthetic peptide directed towards the middle region of human PAPPA2. Synthetic peptide located within the following region: ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL