Antibodies

Jump to Filters
View as table Download
Myeloid zinc finger 1 (MZF1) Rabbit Polyclonal Antibody
TA314689

USD 380.00

4 Weeks

Rabbit polyclonal anti-MZF-1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human MZF-1.
Myeloid zinc finger 1 (MZF1) Rabbit Polyclonal Antibody
TA343390

USD 539.00

5 Days

Rabbit Polyclonal Anti-MZF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MZF1 antibody: synthetic peptide directed towards the N terminal of human MZF1. Synthetic peptide located within the following region: RPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFR