Myeloid zinc finger 1 (MZF1) Rabbit Polyclonal Antibody

CAT#: TA343390

Rabbit Polyclonal Anti-MZF1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of myeloid zinc finger 1 (MZF1), transcript variant 2
    • 100 ug

USD 436.00

Other products for "Myeloid zinc finger 1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MZF1 antibody: synthetic peptide directed towards the N terminal of human MZF1. Synthetic peptide located within the following region: RPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 82 kDa
Gene Name myeloid zinc finger 1
Background MZF1 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 SCAN box domain. MZF1 may be one regulator of transcriptional events during hemopoietic development.
Synonyms MZF-1; MZF1B; ZFP98; ZNF42; ZSCAN6
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 92%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.