Antibodies

View as table Download

Rabbit Polyclonal LOX Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen Within the range of amino acids 305-338 of human LOX protein were used as the immunogen.

Rabbit Polyclonal Calreticulin Antibody

Applications Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Hamster, Primate
Conjugation Unconjugated
Immunogen A fusion protein to mouse Calreticulin [UniProt# P14211]

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)

Rabbit Polyclonal SEMA3B Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200).

Rabbit polyclonal antibody to Amphiphysin (amphiphysin)

Applications IHC, WB
Reactivities Human (Predicted: Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 194 of Amphiphysin (Uniprot ID#P49418)

SFTPC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Bovine, Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SFTPC.

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Dog, Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)

Rabbit Polyclonal antibody to Inhibin beta A (inhibin, beta A)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Feline, Pig, Chicken, Sheep, Bovine)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 362 and 426 of Inhibin beta A

Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum

Applications ELISA, IHC, R, WB
Reactivities Bovine, Deer, Goat, Human, Sheep
Conjugation Unconjugated
Immunogen Bovine Luteinizing Hormone

Rabbit polyclonal IGFBP2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Bovine, Pig)
Conjugation Unconjugated
Immunogen This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2.

Rabbit Polyclonal AG-2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Bovine
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of mouse AGR2 (within residues 1-50). [Swiss-Prot# O88312]

Rabbit Polyclonal antibody to alpha 2 Antiplasmin (serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rabbit, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 188 and 453 of alpha 2 Antiplasmin (Uniprot ID#P08697)

Rabbit Polyclonal antibody to AGR3 (anterior gradient homolog 3 (Xenopus laevis))

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 166 of AGR3 (Uniprot ID#Q8TD06)

Rabbit polyclonal antibody to Factor IX (coagulation factor IX)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Dog, Monkey, Pig, Rabbit, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 217 and 453 of Factor IX (Uniprot ID#P00740)