Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Equine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
XPR1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Bat, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 16 amino acid peptide from the N-terminal cytoplasmic domain of human XPR1. |
Rabbit Polyclonal NFkB p65 NLS Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
Rabbit Polyclonal SR1 Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Bovine, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 45-76 of human Sorcin was used as immunogen, GenBank no NP-003121. |
Rabbit Polyclonal beta-Arrestin 2 Antibody
| Applications | IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1. |
Rabbit Polyclonal GRAIL/RNF128 Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1. |
5HT7 Receptor (HTR7) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Bovine, Bat, Canine, Equine, Guinea Pig, Hamster, Monkey, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 20 amino acid peptide from C-terminal region of Human HTR7 / 5-HT7 |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Germany
Japan
United Kingdom
China
